Structure of PDB 6zj3 Chain LY

Receptor sequence

>6zj3LY (length=134) Species: 3039 (Euglena gracilis)

GKGTGNKFRISLALPVAAVMNCADNTGAKNLYIISVKGIKGRLNKLPAAC
VGDMVLATVKKGKPELRKKVMPAIVVRQRKHWRRKDGTFIYFEDNAGVIC
NPKGEMKGSGVTGPVAKEAADIWPRVASNAGTVV

3D structure

• PDB: 6zj3 Cryo-EM structure of the highly atypical cytoplasmic ribosome of Euglena gracilis.
• Chain: LY
• Resolution: 3.15 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LY	A19 P21 A23 A24 V25 I40 R48 N50 K51 L52 T64 K66 K74 V76 R85 K86 N101	A13 P15 A17 A18 V19 I34 R42 N44 K45 L46 T58 K60 K68 V70 R79 K80 N95
BS02	rna	LY	S41 K43 G44 I45 K46 G47 R48 L49 N50 K51	S35 K37 G38 I39 K40 G41 R42 L43 N44 K45
BS03	rna	LY	T10 G11 N12 K13 F14 R15 S17 K46 R48 K86 H87 R89 F95	T4 G5 N6 K7 F8 R9 S11 K40 R42 K80 H81 R83 F89

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sat Nov 30 00:22:50 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6zj3', asym_id = 'LY', title = 'Cryo-EM structure of the highly atypical cytoplasmic ribosome of Euglena gracilis.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6zj3', asym_id='LY', title='Cryo-EM structure of the highly atypical cytoplasmic ribosome of Euglena gracilis.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '6zj3', asym_id = 'LY'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='6zj3', asym_id='LY')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>