Structure of PDB 4v3p Chain LY

Receptor sequence

>4v3pLY (length=130) Species: 4565 (Triticum aestivum)

MKRNPRVTSSRRKCRKAHFTAPSSVRRVLMSAALSTELRHKYNVRSIPIR
KDDEVQVVRGSYKGREGKVVQVYRRRWVIHVERITREKVNGSTVNVGIHP
SKVVVTKLKLDKDRKAILDRKASGRAADKA

3D structure

• PDB: 4v3p The molecular structure of the left-handed supra-molecular helix of eukaryotic polyribosomes.
• Chain: LY
• Resolution: 34.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LY	M1 K2 R3 N4 R6 T8 S9 S10 R11 K13 R15 V28 R39 R45 R59 G60 R86 K88 V89 V94 R120 K121 G124 R125 D128 K129	M1 K2 R3 N4 R6 T8 S9 S10 R11 K13 R15 V28 R39 R45 R59 G60 R86 K88 V89 V94 R120 K121 G124 R125 D128 K129
BS02	rna	LY	R11 R12 R15 K16 F19 S23 S24 R26 R27 M30 I49 R50 K51 D52 V72 Y73 R74 R75 K109 D111 K112 D113 R114 R120	R11 R12 R15 K16 F19 S23 S24 R26 R27 M30 I49 R50 K51 D52 V72 Y73 R74 R75 K109 D111 K112 D113 R114 R120

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Fri Nov 15 13:24:48 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4v3p', asym_id = 'LY', title = 'The molecular structure of the left-handed supra-molecular helix of eukaryotic polyribosomes.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4v3p', asym_id='LY', title='The molecular structure of the left-handed supra-molecular helix of eukaryotic polyribosomes.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003723,0003735,0005840,0006412,0015934', uniprot = '', pdbid = '4v3p', asym_id = 'LY'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003723,0003735,0005840,0006412,0015934', uniprot='', pdbid='4v3p', asym_id='LY')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>