Structure of PDB 8pv7 Chain LX

Receptor sequence

>8pv7LX (length=145) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence]

SKAAKGAQAKKAAQAALKGVHSHKKTKVRKSTTFHRPKTLVLSRAPKYPR
KSIPHEPRLDEHKIIIHPLNTEGALKKIEEQNTLVFIVDVKANKAQIKQA
LKKLYDIDTVKINTLIRPDGTKKAFARLTPDVDALDIAATKLGLV

3D structure

PDB

8pv7 Structural insights into coordinating 5S RNP rotation with ITS2 pre-RNA processing during ribosome formation.

Chain

Resolution

2.12 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LX	H32 K36 K41 H46 R47 P48 K49 L53 R55 A56 K58 Y59 R61 T82 E83 K88 Q92 N104 K105 K122 N124 T125 L126 I127 P129 K133 K134 F136 R138	H21 K25 K30 H35 R36 P37 K38 L42 R44 A45 K47 Y48 R50 T71 E72 K77 Q81 N93 K94 K111 N113 T114 L115 I116 P118 K122 K123 F125 R127
BS02	rna	LX	H32 K35 P48 T50 L51 R55 K62 H66 P68 R69 K74 A106 Q107	H21 K24 P37 T39 L40 R44 K51 H55 P57 R58 K63 A95 Q96

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links