Structure of PDB 7nrc Chain LX

Receptor sequence

>7nrcLX (length=136) Species: 559292 (Saccharomyces cerevisiae S288C)

SGNGAQGTKFRISLGLPVGAIMNCADNSGARNLYIIAVKGSGSRLNRLPA
ASLGDMVMATVKKGKPELRKKVMPAIVVRQAKSWRRRDGVFLYFEDNAGV
IANPKGEMKGSAITGPVGKECADLWPRVASNSGVVV

3D structure

• PDB: 7nrc Structure of Gcn1 bound to stalled and colliding 80S ribosomes.
• Chain: LX
• Resolution: 3.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LX	N28 R32 K64 P67 S112	N27 R31 K63 P66 S111
BS02	rna	LX	G3 A6 G8 T9 K10 F11 R12 S14 G16 P18 A21 I22 I37 K40 G43 S44 R45 L46 N47 R48 L49 T61 K63 K71 V73 A82 K83 F92	G2 A5 G7 T8 K9 F10 R11 S13 G15 P17 A20 I21 I36 K39 G42 S43 R44 L45 N46 R47 L48 T60 K62 K70 V72 A81 K82 F91

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0070180 large ribosomal subunit rRNA binding

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7nrc, PDBe:7nrc, PDBj:7nrc
• PDBsum: 7nrc
• PubMed: 33790014
• UniProt: P0CX41|RL23A_YEAST Large ribosomal subunit protein uL14A (Gene Name=RPL23A)