Structure of PDB 6zj3 Chain LX

Receptor sequence

>6zj3LX (length=219) Species: 3039 (Euglena gracilis)

VKKGNAPVPNAHFHKHWNPTGSQKGHVRCFFKQGPQKKIRRARRQKKAAA
VFPRPVKGPLRPIVHCKSQRFNMKTRLGRGFTTLELKTAGLTDRRYARTI
GISVDRRRRNHCEESLALNAERIKTYLSKLVLFPLKAGKKLPEGVTEEDI
KNPVQSKQDGFPKASSYGKNALKPEAPRKLTDQEKKRLTFQFLRKVQRDT
KMVGKRIKRKAKKEAKAAK

3D structure

• PDB: 6zj3 Cryo-EM structure of the highly atypical cytoplasmic ribosome of Euglena gracilis.
• Chain: LX
• Resolution: 3.15 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LX	F32 K33 P36 Q37 I40	F31 K32 P35 Q36 I39
BS02	rna	LX	N11 H13 H15 K16 H17 K48 A51 R62 V65 H66 C67 K68 S69 F72 N73 R77 G79 R80 R96 R99 D106 R107 R108 R109 H112	N10 H12 H14 K15 H16 K47 A50 R61 V64 H65 C66 K67 S68 F71 N72 R76 G78 R79 R95 R98 D105 R106 R107 R108 H111
BS03	rna	LX	K25 R29 T93 D94 R107 R110 K137 K140	K24 R28 T92 D93 R106 R109 K136 K139
BS04	rna	LX	V2 K3 K4 P8 P10 A12 F14 H15 W18 N19 T21 S23 Q24 F32 Q34 G35 P36 K39 R41 R42 R45 K187 R188 L189 F191 Q192 F193 R195 K196 Q198 R199 K202 R207 R210	V1 K2 K3 P7 P9 A11 F13 H14 W17 N18 T20 S22 Q23 F31 Q33 G34 P35 K38 R40 R41 R44 K186 R187 L188 F190 Q191 F192 R194 K195 Q197 R198 K201 R206 R209
BS05	rna	LX	R199 K202 V204 G205 K206 K209 K213	R198 K201 V203 G204 K205 K208 K212

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sat Nov 16 07:41:48 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6zj3', asym_id = 'LX', title = 'Cryo-EM structure of the highly atypical cytoplasmic ribosome of Euglena gracilis.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6zj3', asym_id='LX', title='Cryo-EM structure of the highly atypical cytoplasmic ribosome of Euglena gracilis.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '6zj3', asym_id = 'LX'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='6zj3', asym_id='LX')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>