Structure of PDB 6t7i Chain LX

Receptor sequence

>6t7iLX (length=121) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

KALKVRTSATFRLPKTLKLARAPKYASKAVPHYNRLDSYKVIEQPITSET
AMKKVEDGNILVFQVSMKANKYQIKKAVKELYEVDVLKVNTLVRPNGTKK
AYVRLTADYDALDIANRIGYI

3D structure

PDB

6t7i Molecular mechanism of translational stalling by inhibitory codon combinations and poly(A) tracts.

Chain

Resolution

3.2 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LX	L24 K25 L38 R42 S48 K49 H53 Y54 N55 K61 K89 Y93	L3 K4 L17 R21 S27 K28 H32 Y33 N34 K40 K68 Y72
BS02	rna	LX	A30 R33 L34 P35 K36 K39 R42 P44 K45 Y46 S69 T71 N91 K92 Y93 K109 N111 T112 V114 P116 K120 K121 Y123 R125	A9 R12 L13 P14 K15 K18 R21 P23 K24 Y25 S48 T50 N70 K71 Y72 K88 N90 T91 V93 P95 K99 K100 Y102 R104

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding
GO:0019843	rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:0030687	preribosome, large subunit precursor
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:6t7i, PDBe:6t7i, PDBj:6t7i
PDBsum	6t7i
PubMed	31858614
UniProt	P04456\|RL25_YEAST Large ribosomal subunit protein uL23 (Gene Name=RPL25)