Structure of PDB 8k2a Chain LW

Receptor sequence
>8k2aLW (length=143) Species: 9606 (Homo sapiens) [Search protein sequence]
MARNVVYPLYRLGGPQLRVFRTNFFIQLVRPGVAQPEDTVQFRIPMEMTR
VDLRNYLEGIYNVPVAAVRTRVQHGSNKRRDHRNVRIKKPDYKVAYVQLA
HGQTFTFPDLFPEDDLYSMLEEERQQRQSSDPRRGGVPSWFGL
3D structure
PDB8k2a Structural basis for differential inhibition of eukaryotic ribosomes by tigecycline.
ChainLW
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna LW N4 V6 L9 G32 Q41 R43 T49 R50 V51 R69 V72 Q73 H74 S76 K78 R79 N84 K93 Y96 N4 V6 L9 G32 Q41 R43 T49 R50 V51 R69 V72 Q73 H74 S76 K78 R79 N84 K93 Y96
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0001650 fibrillar center
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005762 mitochondrial large ribosomal subunit
GO:0005840 ribosome
GO:0044391 ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8k2a, PDBe:8k2a, PDBj:8k2a
PDBsum8k2a
PubMed38942792
UniProtQ16540|RM23_HUMAN Large ribosomal subunit protein uL23m (Gene Name=MRPL23)

[Back to BioLiP]