Structure of PDB 8fks Chain LW

Receptor sequence

>8fksLW (length=69) Species: 9606 (Homo sapiens) [Search protein sequence]

KTHTLCRRCGSKAYHLQKSTCGKCGYPAKRKRKAKAKRRNTTGTGRMRHL
KIVYRRFRHGFREGTTPKP

3D structure

PDB

8fks Principles of human pre-60 S biogenesis.

Chain

Resolution

2.88 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	LW	R20 R21 Y39 K44 T59 G62 R63 M64 R65 H66 L67 V70 R72 F74 H76 R79 E80 G81 T82 P84	R7 R8 Y26 K31 T42 G45 R46 M47 R48 H49 L50 V53 R55 F57 H59 R62 E63 G64 T65 P67
BS02	rna	LW	H16 K25 H28 R43 R45 K46 K52 R55 R56 T58 T59 Y71 K85	H3 K12 H15 R30 R32 K33 K35 R38 R39 T41 T42 Y54 K68
BS03	ZN	LW	C19 C22 C34 C37	C6 C9 C21 C24

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding
GO:0046872	metal ion binding
GO:0097371	MDM2/MDM4 family protein binding
GO:1990948	ubiquitin ligase inhibitor activity

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:1901798	positive regulation of signal transduction by p53 class mediator

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:0022626	cytosolic ribosome
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:8fks, PDBe:8fks, PDBj:8fks
PDBsum	8fks
PubMed	37410842
UniProt	P61927\|RL37_HUMAN Large ribosomal subunit protein eL37 (Gene Name=RPL37)