Structure of PDB 7bhp Chain LW

Receptor sequence
>7bhpLW (length=42) Species: 9606 (Homo sapiens) [Search protein sequence]
CSFSGYKIYPGHNAKCESAFLSKRNPRQINWTVLYRRKHKKG
3D structure
PDB7bhp Dynamic association of human Ebp1 with the ribosome.
ChainLW
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna LW K35 R44 Q48 N50 W51 R56 K61 K15 R24 Q28 N30 W31 R36 K41
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0045296 cadherin binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0010458 exit from mitosis
GO:0021554 optic nerve development
GO:0031290 retinal ganglion cell axon guidance
GO:0060041 retina development in camera-type eye
Cellular Component
GO:0005737 cytoplasm
GO:0005783 endoplasmic reticulum
GO:0005829 cytosol
GO:0005840 ribosome
GO:0016020 membrane
GO:0022625 cytosolic large ribosomal subunit
GO:0022626 cytosolic ribosome
GO:0045202 synapse
GO:0070062 extracellular exosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7bhp, PDBe:7bhp, PDBj:7bhp
PDBsum7bhp
PubMed33479117
UniProtP83731|RL24_HUMAN Large ribosomal subunit protein eL24 (Gene Name=RPL24)

[Back to BioLiP]