Structure of PDB 5wlc Chain LW

Receptor sequence

>5wlcLW (length=438) Species: 1247190 (Saccharomyces cerevisiae BY4741) [Search protein sequence]

QTKDKKLRAGLKKIDEQYKKAVSSAAATDYLLPESNGYLEPENELEKTFK
VQQSEIKSSVDVSTANKALDLSLKEFGPYHIKYAKNGTHLLITGRKGHVA
SMDWRKGQLRAELFLNETCHSATYLQNEQYFAVAQKKYTFIYDHEGTELH
RLKQHIEARHLDFLPYHYLLVTAGETGWLKYHDVSTGQLVSELRTKAGPT
MAMAQNPWNAVMHLGHSNGTVSLWSPSMPEPLVKLLSARGPVNSIAIDRS
GYYMATTGADRSMKIWDIRNFKQLHSVESLPTPGTNVSISDTGLLALSRG
PHVTLWKDALKLSGDSKPCFGSMGGNPHRNTPYMSHLFAGNKVENLGFVP
FEDLLGVGHQTGITNLIVPGAGEANYDALELNPFETKKQRQEQEVRTLLN
KLPADTITLDPNSIGSVDKRSSTIRLNAKDLAQTTMDA

3D structure

PDB

5wlc The complete structure of the small-subunit processome.

Chain

Resolution

3.8 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	LW	F84 K85 Q143 K172 H179 I191 T211 W213 K215 L224 E227 K231 A232 G233 R274 P316 F355 G356 S357 M358 G359 G360 R364 A374 Q426	F49 K50 Q108 K137 H144 I156 T176 W178 K180 L189 E192 K196 A197 G198 R239 P281 F320 G321 S322 M323 G324 G325 R329 A339 Q391
BS02	rna	LW	D39 K40 K41 A44 K464 A467	D4 K5 K6 A9 K429 A432
BS03	rna	LW	E180 T221 L414 K423 R431	E145 T186 L379 K388 R396

Gene Ontology

	Molecular Function
GO:0003674	molecular_function
GO:0005515	protein binding

	Biological Process
GO:0000447	endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000462	maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000472	endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000480	endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006364	rRNA processing
GO:0030490	maturation of SSU-rRNA
GO:0042254	ribosome biogenesis

	Cellular Component
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005730	nucleolus
GO:0030686	90S preribosome
GO:0030688	preribosome, small subunit precursor
GO:0032040	small-subunit processome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5wlc, PDBe:5wlc, PDBj:5wlc
PDBsum	5wlc
PubMed	28945246
UniProt	P40055\|UTP7_YEAST U3 small nucleolar RNA-associated protein 7 (Gene Name=UTP7)

[Back to BioLiP]