Structure of PDB 6rm3 Chain LV0

Receptor sequence
>6rm3LV0 (length=135) Species: 6039 (Vairimorpha necatrix) [Search protein sequence]
KKVARKPHRRMTKGCQMETLLKCADNSGAKLLKVIGVRGYKGRLNRYPAA
APGDIVVVSCKKGKPDLRKKVHYAILVRQKKVWRREDGTHIGFEDNAAVL
ITAKGDMRGGQISGSLPKEVAECWPKISNSGNSIN
3D structure
PDB6rm3 Evolutionary compaction and adaptation visualized by the structure of the dormant microsporidian ribosome.
ChainLV0
Resolution3.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna LV0 H19 R21 Q27 E29 I46 R49 K52 G53 R54 L55 N56 R57 Y58 K80 K92 H8 R10 Q16 E18 I35 R38 K41 G42 R43 L44 N45 R46 Y47 K69 K81
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Wed Dec 4 19:52:58 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6rm3', asym_id = 'LV0', title = 'Evolutionary compaction and adaptation visualize...structure of the dormant microsporidian ribosome.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6rm3', asym_id='LV0', title='Evolutionary compaction and adaptation visualize...structure of the dormant microsporidian ribosome.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '6rm3', asym_id = 'LV0'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='6rm3', asym_id='LV0')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>