Structure of PDB 8k82 Chain LV

Receptor sequence
>8k82LV (length=134) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
NGAQGTKFRISLGLPVGAIMNCADNSGARNLYIIAVKGSGSRLNRLPAAS
LGDMVMATVKKGKPELRKKVMPAIVVRQAKSWRRRDGVFLYFEDNAGVIA
NPKGEMKGSAITGPVGKECADLWPRVASNSGVVV
3D structure
PDB8k82 Structural basis for differential inhibition of eukaryotic ribosomes by tigecycline.
ChainLV
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna LV R32 K66 R29 K63
BS02 rna LV T9 K10 F11 R12 S14 G16 P18 I22 I37 V39 K40 S42 G43 S44 R45 L46 N47 R48 L49 T61 K63 K71 K83 R86 F92 T6 K7 F8 R9 S11 G13 P15 I19 I34 V36 K37 S39 G40 S41 R42 L43 N44 R45 L46 T58 K60 K68 K80 R83 F89
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0002181 cytoplasmic translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8k82, PDBe:8k82, PDBj:8k82
PDBsum8k82
PubMed38942792
UniProtP0CX41|RL23A_YEAST Large ribosomal subunit protein uL14A (Gene Name=RPL23A)

[Back to BioLiP]