Structure of PDB 8rxx Chain LU

Receptor sequence

>8rxxLU (length=122) Species: 347515 (Leishmania major strain Friedlin)

VAVRAKVGSRSYVRQKQLAKGKKVFKIDCSIPAADGIFSEDVLGNFEQFF
QDNTKLNGRKGKLSDKVRLSMNDNVLTISTTMAYRKKYFKYLTKKFLKKK
DLRDWIRILATGKGTYQLKYFN

3D structure

• PDB: 8rxx Structural and mechanistic insights into the function of Leishmania ribosome lacking a single pseudouridine modification.
• Chain: LU
• Resolution: 2.97 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LU	V2 A3 R5 K7 V8 G9	V1 A2 R4 K6 V7 G8
BS02	rna	LU	Q16 K56 N58 G59 K61 Y85 R86 K87 K88 Y89 K91 Y92 K96 K99 K100 R104 R108 L110 A111 K114 K120	Q15 K55 N57 G58 K60 Y84 R85 K86 K87 Y88 K90 Y91 K95 K98 K99 R103 R107 L109 A110 K113 K119
BS03	rna	LU	K7 V8 G9 S10 S12 Y13 R60	K6 V7 G8 S9 S11 Y12 R59

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005730 nucleolus
• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8rxx, PDBe:8rxx, PDBj:8rxx
• PDBsum: 8rxx
• PubMed: 38722744
• UniProt: Q4Q0X2