Structure of PDB 8bsj Chain LU

Receptor sequence

>8bsjLU (length=150) Species: 5741 (Giardia intestinalis) [Search protein sequence]

THSQGYRCKTRYCFARKFRRHGMANLTTYNRVYKLGQYVNIKVNGAYHKG
MPHRYYNGRTGTIFNIGPRALGVQIQKRVRGRIMLKRINVRLEHVHPSDC
RKNHLERVAANDAARRLAKETGQPRQNALPRAAHVVSIASAIDITPLKYD

3D structure

PDB

8bsj Insights into translocation mechanism and ribosome evolution from cryo-EM structures of translocation intermediates of Giardia intestinalis.

Chain

Resolution

6.49 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LU	R20 N26 T28	R19 N25 T27
BS02	rna	LU	T2 H3 S4 Q5 G6 Y7 R8 C9 K10 R12 Y13 A16 R17 F19 H22 G23 K35 Y39 N41 K43 A47 H49 K50 G51 H54 R55 Y57 N58 G59 R60 T61 P69 R70 A71 Q77 K78 V80 R81 R83 K87 R88 N90 R92 D100 C101 R102 N104 H105 R108 V109 N112 R116 K120 R131 N133	T1 H2 S3 Q4 G5 Y6 R7 C8 K9 R11 Y12 A15 R16 F18 H21 G22 K34 Y38 N40 K42 A46 H48 K49 G50 H53 R54 Y56 N57 G58 R59 T60 P68 R69 A70 Q76 K77 V79 R80 R82 K86 R87 N89 R91 D99 C100 R101 N103 H104 R107 V108 N111 R115 K119 R125 N127

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8bsj, PDBe:8bsj, PDBj:8bsj
PDBsum	8bsj
PubMed	36912103
UniProt	A8B2Q4

[Back to BioLiP]