Structure of PDB 7mq9 Chain LU

Receptor sequence

>7mq9LU (length=445) Species: 9606 (Homo sapiens) [Search protein sequence]

MKVKMLSRNPDNYVRETKLDLQRVPRNYDPALHPFEVPREYIRALNATKL
ERVFAKPFLASLDGHRDGVNCLAKHPEKLATVLSGACDGEVRIWNLTQRN
CIRTIQAHEGFVRGICTRFCGTSFFTVGDDKTVKQWKMDGPGYGDEEEPL
HTILGKTVYTGIDHHWKEAVFATCGQQVDIWDEQRTNPICSMTWGFDSIS
SVKFNPIETFLLGSCASDRNIVLYDMRQATPLKKVILDMRTNTICWNPME
AFIFTAANEDYNLYTFDMRALDTPVMVHMDHVSAVLDVDYSPTGKEFVSA
SFDKSIRIFPVDKSRSREVYHTKRMQHVICVKWTSDSKYIMCGSDEMNIR
LWKANASEKLGVLTSREKAAKDYNQKLKEKFQHYPHIKRIARHRHLPKSI
YSQIQEQRIMKEARRRKEVNRIKHSKPGSVPLVSEKKKHVVAVVK

3D structure

PDB

7mq9 Nucleolar maturation of the human small subunit processome.

Chain

Resolution

3.87 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LU	R389 H393 L396 Y401 M410 R414 R416 K417 N420 H424	R389 H393 L396 Y401 M410 R414 R416 K417 N420 H424
BS02	rna	LU	R15 K18 K49 L50 R52 F54 K56 P57 F58 S61 E318 Y320 K323 R324 R350 S357 K359 T364 R366 E367 H395	R15 K18 K49 L50 R52 F54 K56 P57 F58 S61 E318 Y320 K323 R324 R350 S357 K359 T364 R366 E367 H395

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0005515	protein binding
GO:0030331	nuclear estrogen receptor binding
GO:1990756	ubiquitin-like ligase-substrate adaptor activity

	Biological Process
GO:0000462	maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0001555	oocyte growth
GO:0006364	rRNA processing
GO:0007056	spindle assembly involved in female meiosis
GO:0016567	protein ubiquitination
GO:0042254	ribosome biogenesis
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0044725	epigenetic programming in the zygotic pronuclei
GO:0046697	decidualization

	Cellular Component
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005730	nucleolus
GO:0005813	centrosome
GO:0005829	cytosol
GO:0030054	cell junction
GO:0032040	small-subunit processome
GO:0080008	Cul4-RING E3 ubiquitin ligase complex
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7mq9, PDBe:7mq9, PDBj:7mq9
PDBsum	7mq9
PubMed	34516797
UniProt	Q9NV06\|DCA13_HUMAN DDB1- and CUL4-associated factor 13 (Gene Name=DCAF13)

[Back to BioLiP]