Structure of PDB 6t7t Chain LU

Receptor sequence
>6t7tLU (length=100) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
QKIAKTFTVDVSSPTENGVFDPASYAKYLIDHIKVEGAVGNLGNAVTVTE
DGTVVTVVSTAKFSGKYLKYLTKKYLKKNQLRDWIRFVSTKTNEYRLAFY
3D structure
PDB6t7t Molecular mechanism of translational stalling by inhibitory codon combinations and poly(A) tracts.
ChainLU
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna LU K13 K42 G45 S72 K74 Y75 K77 Y78 K81 K82 K85 K86 R90 R94 V96 S97 T100 N101 Y103 K5 K34 G37 S64 K66 Y67 K69 Y70 K73 K74 K77 K78 R82 R86 V88 S89 T92 N93 Y95
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6t7t, PDBe:6t7t, PDBj:6t7t
PDBsum6t7t
PubMed31858614
UniProtP05749|RL22A_YEAST Large ribosomal subunit protein eL22A (Gene Name=RPL22A)

[Back to BioLiP]