Structure of PDB 5wlc Chain LU

Receptor sequence

>5wlcLU (length=457) Species: 1247190 (Saccharomyces cerevisiae BY4741)

MKIKTIKRSADDYVPVKSTQESQMPRNLNPELHPFERAREYTKALNATKL
ERMFAKPFVGQLGYGHRDGVYAIAKNYGSLNKLATGSADGVIKYWNMSTR
EEFVSFKAHYGLVTGLCVTQPRFHDKKPDLKSQNFMLSCSDDKTVKLWSI
NVDDYSNKNNEEGLIRTFDGESAFQGIDSHRENSTFATGGAKIHLWDVNR
LKPVSDLSWGADNITSLKFNQNETDILASTGSDNSIVLYDLRTNSPTQKI
VQTMRTNAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLNVFKDHVSAV
MDVDFSPTGDEIVTGSYDKSIRIYKTNHGHSREIYHTKRMQHVFQVKYSM
DSKYIISGSDDGNVRLWRSKAWERSNVKTTREKNKLEYDEKLKERFRHMP
EIKRISRHRHVPQVIKKAQEIKNIELSSIKRREANERRTRKDMPYISERK
KQIVGTV

3D structure

• PDB: 5wlc The complete structure of the small-subunit processome.
• Chain: LU
• Resolution: 3.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LU	R122 H124 D125 E190 V385 K386 T388 K391 N392 E395	R122 H124 D125 E182 V377 K378 T380 K383 N384 E387
BS02	rna	LU	R296 N299 V300 K302 G337 H338 R412 R415 H416 H418 V419 Q421 K438 Y453 R457	R288 N291 V292 K294 G329 H330 R404 R407 H408 H410 V411 Q413 K430 Y445 R449
BS03	rna	LU	S18 T19 K49 R52 F54 A55 K56 P57 F58 Q61 K346 R347 R373 R382 R389 E390 L394 H418	S18 T19 K49 R52 F54 A55 K56 P57 F58 Q61 K338 R339 R365 R374 R381 E382 L386 H410

Gene Ontology

Molecular Function

• GO:0003729 mRNA binding

Biological Process

• GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0006364 rRNA processing
• GO:0030490 maturation of SSU-rRNA
• GO:0042254 ribosome biogenesis

Cellular Component

• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005730 nucleolus
• GO:0030686 90S preribosome
• GO:0032040 small-subunit processome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5wlc, PDBe:5wlc, PDBj:5wlc
• PDBsum: 5wlc
• PubMed: 28945246
• UniProt: P33750|DCA13_YEAST Protein SOF1 (Gene Name=SOF1)