Structure of PDB 8xt2 Chain LT

Receptor sequence

>8xt2LT (length=140) Species: 9606 (Homo sapiens)

LRNRVTDRYFRIQEVLKHARHFRGRKNRCYRLAVRTVIRAFVKCTKARYL
KKKNMRTLWINRITAASQEHGLKYPALIGNLVKCQVELNRKVLADLAIYE
PKTFKSLAALASRRRHEGFAAALGDGKEPEGIFSRVVQYH

3D structure

• PDB: 8xt2 Structural basis for differential inhibition of eukaryotic ribosomes by tigecycline.
• Chain: LT
• Resolution: 3.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LT	L10 R11 N12 R13 V14 D16 R17 H30 F31 R32 R34 K35 R37 C38 Y39 R40 L41 V43 R44 R48 A49 K52 C53 A56 R57 Y58 K60 K61 M64 R65 W68 I69 Y83 P84 N98 R99 K100 F128	L1 R2 N3 R4 V5 D7 R8 H21 F22 R23 R25 K26 R28 C29 Y30 R31 L32 V34 R35 R39 A40 K43 C44 A47 R48 Y49 K51 K52 M55 R56 W59 I60 Y74 P75 N89 R90 K91 F119

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding

Biological Process

• GO:0032543 mitochondrial translation

Cellular Component

• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0005761 mitochondrial ribosome
• GO:0005762 mitochondrial large ribosomal subunit
• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8xt2, PDBe:8xt2, PDBj:8xt2
• PDBsum: 8xt2
• PubMed: 38942792
• UniProt: Q9BYC9|RM20_HUMAN Large ribosomal subunit protein bL20m (Gene Name=MRPL20)