Structure of PDB 8pv8 Chain LT

Receptor sequence

>8pv8LT (length=141) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence]

RKHGQIPLSTYLRTYRVGDIVDIKVNGAVQKGMPHKFYHGKTGVVYNVTK
SAVGVIVYKRVKHRYIEKRINVRIEHVKPSRSREDFLRRVKENAELKKKA
KAEGVPVQLKRQPAMPREAHTVSIADNKPVTLAPVAYETTI

3D structure

PDB

8pv8 Structural insights into coordinating 5S RNP rotation with ITS2 pre-RNA processing during ribosome formation.

Chain

Resolution

2.91 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LT	H22 G23 R35 D41 K43 Q49 K50 G51 Y57 H58 G59 K60 T61 T68 K69 S70 A71 K78 K81 H82 K87 R88 I89 K97 R100 S101 D104 F105 R108 V109 K116 R130	H3 G4 R16 D22 K24 Q30 K31 G32 Y38 H39 G40 K41 T42 T49 K50 S51 A52 K59 K62 H63 K68 R69 I70 K78 R81 S82 D85 F86 R89 V90 K97 R111
BS02	rna	LT	K21 P26 S28	K2 P7 S9

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links