Structure of PDB 8oo0 Chain LT

Receptor sequence

>8oo0LT (length=158) Species: 209285 (Thermochaetoides thermophila) [Search protein sequence]

HAAGLRSGTRYAFSRGFRKHGQIPLSTYLRTYRVGDIVDIKVNGAVQKGM
PHKFYHGKTGVVYNVTKSAVGVIVYKRVKHRYIEKRINVRIEHVKPSRSR
EDFLRRVKENAELKKKAKAEGVPVQLKRQPAMPREAHTVSIADNKPVTLA
PVAYETTI

3D structure

PDB

8oo0 Methionine aminopeptidase 2 and its autoproteolysis product have different binding sites on the ribosome.

Chain

Resolution

3.1 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LT	A4 A5 G6 R8 S9 G10 Y13 R17 F19 H22 Q49 H54 Y57 T61 S70 K78 V80 K87 R88 R92 R100 D104 F105 V109 K110 K120 V126 L128 R130	A2 A3 G4 R6 S7 G8 Y11 R15 F17 H20 Q47 H52 Y55 T59 S68 K76 V78 K85 R86 R90 R98 D102 F103 V107 K108 K118 V124 L126 R128
BS02	rna	LT	R20 S28	R18 S26

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8oo0, PDBe:8oo0, PDBj:8oo0
PDBsum	8oo0
PubMed	38267453
UniProt	G0S0Z3

[Back to BioLiP]