Structure of PDB 8br8 Chain LT

Receptor sequence

>8br8LT (length=170) Species: 184922 (Giardia lamblia ATCC 50803) [Search protein sequence]

MQKYIVYGRRLPSEKFPEPEVFRMTIYAPNEIVAKSRFWYHLKSLKKIKR
THGEILDCQHIEENGDFVKNFGVLLRYRSRVGQHNMYREVRETTSARAMD
KVYSEMAGQCRARYHDIQIINVKEVADEDVRREKVAMFTQKGVRFPHPCP
YVHVKRAARTARFQDRAPHV

3D structure

PDB

8br8 Insights into translocation mechanism and ribosome evolution from cryo-EM structures of translocation intermediates of Giardia intestinalis.

Chain

Resolution

3.35 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LT	S37 R38 Y41 K44 K48 K50 R51 T52 R79 R81 H116	S36 R37 Y40 K43 K47 K49 R50 T51 R78 R80 H115
BS02	rna	LT	R81 V82 N86 M87 Y88 R89 K102 S105 E106 A108 G109 Q110 R112 R114 R133 Y152 R160 F164 Q165 D166 R167 H170 V171	R80 V81 N85 M86 Y87 R88 K101 S104 E105 A107 G108 Q109 R111 R113 R132 Y151 R159 F163 Q164 D165 R166 H169 V170

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8br8, PDBe:8br8, PDBj:8br8
PDBsum	8br8
PubMed	36912103
UniProt	A0A644FBU1

[Back to BioLiP]