Structure of PDB 6zj3 Chain LT

Receptor sequence

>6zj3LT (length=190) Species: 3039 (Euglena gracilis)

MRAIYAVHKTPIPEGVKVFVRNRRIVVRGPRGTLKREMRHVKYDMSVKGK
KNKEFRCEVWFGKNQDEACIKTICSHVANMITGVTKGFRYKMRFAYAHFP
INVSISDDGKAVEIRNFLGEKLIRKVEVREGVSASRTDPAKQKDELVLEG
NDIEKVAQCAADIHQSCLVKNKDIRKFLDGIYVSSKETVV

3D structure

• PDB: 6zj3 Cryo-EM structure of the highly atypical cytoplasmic ribosome of Euglena gracilis.
• Chain: LT
• Resolution: 3.15 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LT	K48 K50 K51 N52	K48 K50 K51 N52
BS02	rna	LT	K170 N171 K172 D173 R175 K176 F177	K170 N171 K172 D173 R175 K176 F177
BS03	rna	LT	H40 Q65 A68 K71 T72 S75 H76 N79 H98 F99 E120 K121 L122 E154 A157 Q158 Q165 F177 K186	H40 Q65 A68 K71 T72 S75 H76 N79 H98 F99 E120 K121 L122 E154 A157 Q158 Q165 F177 K186
BS04	rna	LT	F19 R21 N22 R23 R24 V26 R28 T33 R39 K42 Y43 V59 W60	F19 R21 N22 R23 R24 V26 R28 T33 R39 K42 Y43 V59 W60

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sat Nov 23 02:39:58 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6zj3', asym_id = 'LT', title = 'Cryo-EM structure of the highly atypical cytoplasmic ribosome of Euglena gracilis.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6zj3', asym_id='LT', title='Cryo-EM structure of the highly atypical cytoplasmic ribosome of Euglena gracilis.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003735,0005840,0006412,0019843', uniprot = '', pdbid = '6zj3', asym_id = 'LT'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412,0019843', uniprot='', pdbid='6zj3', asym_id='LT')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>