Structure of PDB 8i9r Chain LS

Receptor sequence

>8i9rLS (length=174) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence]

MGRLQEYQVIGRHLPTEANPNPALYRMRIFAPNEVVAKSRFWYFLRGLKK
VKKATGEIVSVNVISEKHPLKVKNFGIWLRYDSRSGTHNMYKEYRETSRV
AAVEAMYADMAARHRARFRSIHILKVVELEKTEDVKRPYIKQLVAKNLSF
PLPHRVPKISTKKIFSAKRPSTFS

3D structure

PDB

8i9r Mechanism of 5S RNP recruitment and helicase-surveilled rRNA maturation during pre-60S biogenesis.

Chain

Resolution

3.1 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LS	M1 G2 N62 V63 S65 E66 K67 H68 K71 S85 Y91 K92 A111 A112 R113 H114 R115 R117 T132 R137 V144 A145 K146 H154 T161 A167 P170 T172 F173 S174	M1 G2 N62 V63 S65 E66 K67 H68 K71 S85 Y91 K92 A111 A112 R113 H114 R115 R117 T132 R137 V144 A145 K146 H154 T161 A167 P170 T172 F173 S174

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8i9r, PDBe:8i9r, PDBj:8i9r
PDBsum	8i9r
PubMed	37129998
UniProt	G0SCE2

[Back to BioLiP]