Structure of PDB 8pv5 Chain LR

Receptor sequence

>8pv5LR (length=152) Species: 759272 (Thermochaetoides thermophila DSM 1495)

VNLRTQKRLAASVLGCGEGKVWLDPNEVSEISNANSRQSIRKLVADGLII
KKPVTMHSRSRARELNLARRIGRHRGFGKRKGTADARMPQQVLWMRRQRV
LRRLLVKYRASGKIDKHLYHELYHLAKGNTFKHKRALVEHIHRAKAEKAR
ER

3D structure

• PDB: 8pv5 Structural insights into coordinating 5S RNP rotation with ITS2 pre-RNA processing during ribosome formation.
• Chain: LR
• Resolution: 2.86 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LR	V2 N3 L4 R5 T6 K8 R9 L10 G18 E19 K21 W23 L24 P26 R38 R42 K43 V55 T56 M57 H58 S59 R60 S61 R62 R64 L66 R70 R71 R74 H75 R76 G77 F78 G79 K80 R81 K82 G83 T84 A87 R88 M89 P90 Q92 W95 M96 R97 R100 V101 R103 R104 R110 K114 K117 H118 Y120 H121 Y124 H125 L126 K128 G129 N130 H134 K135 R136 H143	V1 N2 L3 R4 T5 K7 R8 L9 G17 E18 K20 W22 L23 P25 R37 R41 K42 V54 T55 M56 H57 S58 R59 S60 R61 R63 L65 R69 R70 R73 H74 R75 G76 F77 G78 K79 R80 K81 G82 T83 A86 R87 M88 P89 Q91 W94 M95 R96 R99 V100 R102 R103 R109 K113 K116 H117 Y119 H120 Y123 H124 L125 K127 G128 N129 H133 K134 R135 H142

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019887 protein kinase regulator activity

Biological Process

• GO:0006412 translation
• GO:0006417 regulation of translation
• GO:0034198 cellular response to amino acid starvation

Cellular Component

• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8pv5, PDBe:8pv5, PDBj:8pv5
• PDBsum: 8pv5
• PubMed: 37921038
• UniProt: G0S9T3