Structure of PDB 8oo0 Chain LR

Receptor sequence

>8oo0LR (length=184) Species: 209285 (Thermochaetoides thermophila) [Search protein sequence]

VNLRTQKRLAASVLGCGEGKVWLDPNEVSEISNANSRQSIRKLVADGLII
KKPVTMHSRSRARELNLARRIGRHRGFGKRKGTADARMPQQVLWMRRQRV
LRRLLVKYRASGKIDKHLYHELYHLAKGNTFKHKRALVEHIHRAKAEKAR
ERQIKEEMDAKRARTKAARERKQERQAAKRNALL

3D structure

PDB

8oo0 Methionine aminopeptidase 2 and its autoproteolysis product have different binding sites on the ribosome.

Chain

Resolution

3.1 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LR	R5 T6 K8 E19 K21 L24 P26 R38 R42 K43 T56 M57 H58 S59 R60 S61 R62 N67 R71 R74 H75 R76 G79 R81 K82 G83 T84 R88 W95 R103 R104 H118 Y120 H121 Y124 H125 K128 K135 H143	R4 T5 K7 E18 K20 L23 P25 R37 R41 K42 T55 M56 H57 S58 R59 S60 R61 N66 R70 R73 H74 R75 G78 R80 K81 G82 T83 R87 W94 R102 R103 H117 Y119 H120 Y123 H124 K127 K134 H142
BS02	rna	LR	M159 R165 R172 R176	M158 R164 R171 R175

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8oo0, PDBe:8oo0, PDBj:8oo0
PDBsum	8oo0
PubMed	38267453
UniProt	G0S9T3

[Back to BioLiP]