Structure of PDB 8i9y Chain LR

Receptor sequence

>8i9yLR (length=119) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence]

VNLRTQKRLAASVLGCGEGKVWLDPNEVSEISNANSRQSIRKLVADGLII
KKPVTMHSRSMPQQVLWMRRQRVLRRLLVKYRASGKIDKHLYHELYHLAK
GNTFKHKRALVEHIHRAKA

3D structure

PDB

8i9y Mechanism of 5S RNP recruitment and helicase-surveilled rRNA maturation during pre-60S biogenesis.

Chain

Resolution

3.1 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LR	V2 N3 L4 R5 K8 L10 G18 E19 K21 W23 L24 P26 S37 R38 Q39 R42 K43 V55 T56 M57 H58 S59 R60 M89 P90 Q91 Q92 W95 R97 R100 R103 R110 H118 Y120 H121 Y124 H125 K128 N130	V1 N2 L3 R4 K7 L9 G17 E18 K20 W22 L23 P25 S36 R37 Q38 R41 K42 V54 T55 M56 H57 S58 R59 M61 P62 Q63 Q64 W67 R69 R72 R75 R82 H90 Y92 H93 Y96 H97 K100 N102

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019887	protein kinase regulator activity

	Biological Process
GO:0006412	translation
GO:0006417	regulation of translation
GO:0034198	cellular response to amino acid starvation

	Cellular Component
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links