Structure of PDB 8fky Chain LR

Receptor sequence
>8fkyLR (length=63) Species: 9606 (Homo sapiens) [Search protein sequence]
PKSACGVCPGRLRGVRAVRLSKTKKHVSRAYGGSMCAKCVRDRIKRAFLI
EEQKIVVKVLKAQ
3D structure
PDB8fky Principles of human pre-60 S biogenesis.
ChainLR
Resolution2.67 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna LR K43 A45 P50 R54 G55 R57 R60 S68 K69 T70 K72 H73 V74 S75 R76 Y78 G79 K2 A4 P9 R13 G14 R16 R19 S21 K22 T23 K25 H26 V27 S28 R29 Y31 G32
BS02 ZN LR C46 C86 C5 C39
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0045296 cadherin binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005783 endoplasmic reticulum
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:0022626 cytosolic ribosome
GO:0045202 synapse
GO:0070062 extracellular exosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8fky, PDBe:8fky, PDBj:8fky
PDBsum8fky
PubMed37410842
UniProtP49207|RL34_HUMAN Large ribosomal subunit protein eL34 (Gene Name=RPL34)

[Back to BioLiP]