Structure of PDB 8br8 Chain LR

Receptor sequence

>8br8LR (length=178) Species: 184922 (Giardia lamblia ATCC 50803) [Search protein sequence]

GIDLKTGIKKRKVERKEPKSPNPYIRLLHNAFKVVYENTGEDFTKVLTKR
LCLSKTNRPVLSVSRLAHLMHKREDKIAVVASTVTNDERLVTIPRMTICA
LKFSATARSRIEKAGGRCMSFDELLAEKPTGDNCVLLQGRRSCRAVCKKF
GSPGRPNSHVKPKGEHKGRRGARGRHSW

3D structure

PDB

8br8 Insights into translocation mechanism and ribosome evolution from cryo-EM structures of translocation intermediates of Giardia intestinalis.

Chain

Resolution

3.35 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LR	G2 I3 K6 K10 K11 R12 K13 V14 E15 R16 P22 K50 L54 S55 K56 T57 N58 V61 S65 R66 H69 T84 T86 N87 D88 E89 R90 K103 S105 A106 T107 Q139 G140 R141 R142 S143 C144 R145 V147 F151 R156 P157 H160 K162 K164 R170 R174 R176 H177 W179	G1 I2 K5 K9 K10 R11 K12 V13 E14 R15 P21 K49 L53 S54 K55 T56 N57 V60 S64 R65 H68 T83 T85 N86 D87 E88 R89 K102 S104 A105 T106 Q138 G139 R140 R141 S142 C143 R144 V146 F150 R155 P156 H159 K161 K163 R169 R173 R175 H176 W178

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:0043232	intracellular non-membrane-bounded organelle
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8br8, PDBe:8br8, PDBj:8br8
PDBsum	8br8
PubMed	36912103
UniProt	A8B4T7

[Back to BioLiP]