Structure of PDB 8bjq Chain LR

Receptor sequence

>8bjqLR (length=171) Species: 4932 (Saccharomyces cerevisiae)

ANLRTQKRLAASVVGVGKRKVWLDPNETSEIAQANSRNAIRKLVKNGTIV
KKAVTVHSKSRTRAHAQSKREGRHSGYGKRKGTREARLPSQVVWIRRLRV
LRRLLAKYRDAGKIDKHLYHVLYKESKGNAFKHKRALVEHIIQAKADAQR
EKALNEEAEARRLKNRAARDR

3D structure

• PDB: 8bjq The dynamic architecture of Map1- and NatB-ribosome complexes coordinates the sequential modifications of nascent polypeptide chains.
• Chain: LR
• Resolution: 3.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LR	L4 R5 T6 K8 G18 K19 R20 K21 W23 L24 S37 R38 R42 K43 K46 T56 H58 S59 K60 S61 R62 R64 R74 H75 G77 Y78 G79 K80 R81 K82 G83 T84 R85 E86 A87 R88 L89 P90 Q92 W95 I96 R100 R103 R104 Y109 R110 K114 H118 Y120 H121 Y124 K125 K128 G129 H134 K135 V139 E140 I143 K146	L3 R4 T5 K7 G17 K18 R19 K20 W22 L23 S36 R37 R41 K42 K45 T55 H57 S58 K59 S60 R61 R63 R73 H74 G76 Y77 G78 K79 R80 K81 G82 T83 R84 E85 A86 R87 L88 P89 Q91 W94 I95 R99 R102 R103 Y108 R109 K113 H117 Y119 H120 Y123 K124 K127 G128 H133 K134 V138 E139 I142 K145

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8bjq, PDBe:8bjq, PDBj:8bjq
• PDBsum: 8bjq
• PubMed: 37079644
• UniProt: P0CX82|RL19A_YEAST Large ribosomal subunit protein eL19A (Gene Name=RPL19A)