Structure of PDB 7z3n Chain LR

Receptor sequence

>7z3nLR (length=184) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence]

VNLRTQKRLAASVLGCGEGKVWLDPNEVSEISNANSRQSIRKLVADGLII
KKPVTMHSRSRARELNLARRIGRHRGFGKRKGTADARMPQQVLWMRRQRV
LRRLLVKYRASGKIDKHLYHELYHLAKGNTFKHKRALVEHIHRAKAEKAR
ERQIKEEMDAKRARTKAARERKQERQAAKRNALL

3D structure

PDB

7z3n Structural inventory of cotranslational protein folding by the eukaryotic RAC complex.

Chain

Resolution

3.2 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LR	N3 R5 K8 R9 E19 K21 W23 L24 P26 R38 R42 K43 M57 H58 S59 R60 R62 N67 R70 R71 R74 H75 R76 G77 F78 G79 K80 R81 K82 G83 T84 R88 Q92 W95 M96 R100 V101 R103 R104 R110 K114 H118 Y120 H121 Y124 K128 H143	N2 R4 K7 R8 E18 K20 W22 L23 P25 R37 R41 K42 M56 H57 S58 R59 R61 N66 R69 R70 R73 H74 R75 G76 F77 G78 K79 R80 K81 G82 T83 R87 Q91 W94 M95 R99 V100 R102 R103 R109 K113 H117 Y119 H120 Y123 K127 H142
BS02	rna	LR	M159 K162 R165 T166 R172 R176	M158 K161 R164 T165 R171 R175

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7z3n, PDBe:7z3n, PDBj:7z3n
PDBsum	7z3n
PubMed	37081320
UniProt	G0S9T3

[Back to BioLiP]