Structure of PDB 7old Chain LR

Receptor sequence

>7oldLR (length=184) Species: 759272 (Thermochaetoides thermophila DSM 1495)

VNLRTQKRLAASVLGCGEGKVWLDPNEVSEISNANSRQSIRKLVADGLII
KKPVTMHSRSRARELNLARRIGRHRGFGKRKGTADARMPQQVLWMRRQRV
LRRLLVKYRASGKIDKHLYHELYHLAKGNTFKHKRALVEHIHRAKAEKAR
ERQIKEEMDAKRARTKAARERKQERQAAKRNALL

3D structure

• PDB: 7old High-resolution structures of a thermophilic eukaryotic 80S ribosome reveal atomistic details of translocation.
• Chain: LR
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LR	N3 R5 T6 K8 G18 E19 K21 L24 P26 S37 R38 R42 T56 H58 S59 R60 S61 R62 R64 N67 R71 R74 H75 R76 G77 F78 G79 R81 K82 G83 T84 R88 W95 R100 R103 R104 R110 H118 Y120 H121 Y124 H125 K135 R136 H143	N2 R4 T5 K7 G17 E18 K20 L23 P25 S36 R37 R41 T55 H57 S58 R59 S60 R61 R63 N66 R70 R73 H74 R75 G76 F77 G78 R80 K81 G82 T83 R87 W94 R99 R102 R103 R109 H117 Y119 H120 Y123 H124 K134 R135 H142
BS02	rna	LR	M159 R163 R165 R172 R176	M158 R162 R164 R171 R175

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit

External links

• PDB: RCSB:7old, PDBe:7old, PDBj:7old
• PDBsum: 7old
• PubMed: 35079002
• UniProt: G0S9T3