Structure of PDB 8y0u Chain LQ

Receptor sequence

>8y0uLQ (length=185) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

GIDHTSKQHKRSGHRTAPKSDNVYLKLLVKLYTFLARRTDAPFNKVVLKA
LFLSKINRPPVSVSRIARALKQEGAANKTVVVVGTVTDDARIFEFPKTTV
AALRFTAGARAKIVKAGGECITLDQLAVRAPKGQNTLILRGPRNSREAVR
HFGMGPHKGKAPRILSTGRKFERARGRRRSKGFKV

3D structure

PDB

8y0u dormant ribosome with STM1

Chain

Resolution

3.59 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LQ	G2 H5 T6 H10 R12 S13 G14 H15 R16 S21 K31 R38 F44 S55 K56 I57 S65 R66 R69 Q73 E74 T88 D89 D90 R92 I93 T107 Q135 N136 T137 I139 R141 R144 N145 S146 E148 R151 F153 P157 G160 A162 R164 S167 R170 K171 R174 R176 R178 R179 R180 S181 K182 G183 F184 K185	G1 H4 T5 H9 R11 S12 G13 H14 R15 S20 K30 R37 F43 S54 K55 I56 S64 R65 R68 Q72 E73 T87 D88 D89 R91 I92 T106 Q134 N135 T136 I138 R140 R143 N144 S145 E147 R150 F152 P156 G159 A161 R163 S166 R169 K170 R173 R175 R177 R178 R179 S180 K181 G182 F183 K184

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:0043232	intracellular non-membrane-bounded organelle
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8y0u, PDBe:8y0u, PDBj:8y0u
PDBsum	8y0u
PubMed	38698775
UniProt	P0CX49\|RL18A_YEAST Large ribosomal subunit protein eL18A (Gene Name=RPL18A)

[Back to BioLiP]