Structure of PDB 8rxx Chain LQ

Receptor sequence

>8rxxLQ (length=201) Species: 347515 (Leishmania major strain Friedlin)

VSLKLQARLASSILGCGRARVWLDPNEAVEIQNANSRKSVRKLIKDGFII
RKPVKVHSRARWRKMKEAKDMGRHNGVGRREGSREARMPSKELWMRRLRI
LRRLLRKYRADKKIDRHVYRDLYMRAKGNVFRNKRNLVEHIHKIKNEKKK
ERQLAEQLAAKHLRDEQNRNKARKQELKKREKERERARRDDAAAAAQKKK
A

3D structure

• PDB: 8rxx Structural and mechanistic insights into the function of Leishmania ribosome lacking a single pseudouridine modification.
• Chain: LQ
• Resolution: 2.97 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LQ	V2 S3 L4 R9 L10 R19 W23 L24 P26 S37 R38 R42 K92 W95 M125 K128 G129 N130	V1 S2 L3 R8 L9 R18 W22 L23 P25 S36 R37 R41 K91 W94 M124 K127 G128 N129
BS02	rna	LQ	G18 R19 R21 V55 K56 H58 R60 W63 R74 H75 G77 V78 G79 R80 R81 E82 G83 R85 R88 I101 R104 N134 K135 R136 H143 N147	G17 R18 R20 V54 K55 H57 R59 W62 R73 H74 G76 V77 G78 R79 R80 E81 G82 R84 R87 I100 R103 N133 K134 R135 H142 N146
BS03	rna	LQ	R42 K43 K46 R52 S59 R60 W63 R64 W95 M96 L99 R100 R103 R110 R117 H118 Y120 R121 Y124 K128	R41 K42 K45 R51 S58 R59 W62 R63 W94 M95 L98 R99 R102 R109 R116 H117 Y119 R120 Y123 K127
BS04	rna	LQ	V57 H58 S59 R62 K65	V56 H57 S58 R61 K64
BS05	rna	LQ	R133 R170 R174 E177 L178 R181 K183 R185	R132 R169 R173 E176 L177 R180 K182 R184

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005730 nucleolus
• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8rxx, PDBe:8rxx, PDBj:8rxx
• PDBsum: 8rxx
• PubMed: 38722744
• UniProt: Q4QJ37