Structure of PDB 8oo0 Chain LQ

Receptor sequence

>8oo0LQ (length=183) Species: 209285 (Thermochaetoides thermophila) [Search protein sequence]

GIDLRWKHVRSSHRKAPKSDNVYLKLLVKLYRFLARRTEAPFNKVVLRRL
FMSRINRPPVSLSRIARNLKNGNEKKTVVVVATVTDDNRLLQVPKMEVAA
LRFTAKARARIEAAGGRTLTLDQLALEKPTGANTLLLRGPKNAREAVKHF
GFGPHKHKKPYVRSKGRKFERARGRRRSRGFKV

3D structure

PDB

8oo0 Methionine aminopeptidase 2 and its autoproteolysis product have different binding sites on the ribosome.

Chain

Resolution

3.1 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LQ	H38 V39 R40 S41 H43 R44 S49 K59 R66 M82 S83 R84 I85 N86 S93 R94 R97 K106 T113 D117 N118 R119 R132 T134 A135 A162 N163 T164 R168 K171 N172 R174 E175 F180 K188 R193 R197 K198 R206 S208 F211	H8 V9 R10 S11 H13 R14 S19 K29 R36 M52 S53 R54 I55 N56 S63 R64 R67 K76 T83 D87 N88 R89 R102 T104 A105 A132 N133 T134 R138 K141 N142 R144 E145 F150 K158 R163 R167 K168 R176 S178 F181

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:0043232	intracellular non-membrane-bounded organelle
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8oo0, PDBe:8oo0, PDBj:8oo0
PDBsum	8oo0
PubMed	38267453
UniProt	G0S9B5

[Back to BioLiP]