Structure of PDB 8k82 Chain LQ

Receptor sequence

>8k82LQ (length=185) Species: 4932 (Saccharomyces cerevisiae)

GIDHTSKQHKRSGHRTAPKSDNVYLKLLVKLYTFLARRTDAPFNKVVLKA
LFLSKINRPPVSVSRIARALKQEGAANKTVVVVGTVTDDARIFEFPKTTV
AALRFTAGARAKIVKAGGECITLDQLAVRAPKGQNTLILRGPRNSREAVR
HFGMGPHKGKAPRILSTGRKFERARGRRRSKGFKV

3D structure

• PDB: 8k82 Structural basis for differential inhibition of eukaryotic ribosomes by tigecycline.
• Chain: LQ
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LQ	G2 I3 H5 T6 K8 Q9 H10 R12 S13 G14 H15 R16 S21 K31 F35 R38 R39 P43 F44 L54 S55 I57 N58 P61 S63 S65 R66 R69 K72 Q73 E74 K79 T86 T88 D89 R92 I93 R105 T107 N136 T137 I139 R141 P143 R144 N145 S146 R147 E148 R151 F153 G154 P157 H158 A162 R164 I165 R170 K171 F172 E173 R174 R176 R178 R179 R180 S181 K182 F184 K185	G1 I2 H4 T5 K7 Q8 H9 R11 S12 G13 H14 R15 S20 K30 F34 R37 R38 P42 F43 L53 S54 I56 N57 P60 S62 S64 R65 R68 K71 Q72 E73 K78 T85 T87 D88 R91 I92 R104 T106 N135 T136 I138 R140 P142 R143 N144 S145 R146 E147 R150 F152 G153 P156 H157 A161 R163 I164 R169 K170 F171 E172 R173 R175 R177 R178 R179 S180 K181 F183 K184

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:0043232 intracellular non-membrane-bounded organelle
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8k82, PDBe:8k82, PDBj:8k82
• PDBsum: 8k82
• PubMed: 38942792
• UniProt: P0CX49|RL18A_YEAST Large ribosomal subunit protein eL18A (Gene Name=RPL18A)