Structure of PDB 8br8 Chain LQ

Receptor sequence

>8br8LQ (length=154) Species: 184922 (Giardia lamblia ATCC 50803) [Search protein sequence]

VKYAFKSDNLLVGKSRRDGVKASFKNTYSTCRAIKGMGVKRAFAYLDNVL
NHKEIVPFFKFYKGVGRHSQARGSGTDKGRWPEKSVVVVKDILKQAVSNA
KHAHKKEEDELYVISYCVNRARGRRRRTFRAHGRISKYESQPCHVELIVG
PKPL

3D structure

PDB

8br8 Insights into translocation mechanism and ribosome evolution from cryo-EM structures of translocation intermediates of Giardia intestinalis.

Chain

Resolution

3.35 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LQ	V2 K3 Y4 A5 K7 R33 F60 K61 Y63 N120 R123 H145	V1 K2 Y3 A4 K6 R32 F59 K60 Y62 N119 R122 H144
BS02	rna	LQ	Y4 K15 S16 R17 S24 K26 N27 Y29 R42 K61 F62 Y63 K64 G65 G67 R68 H69 S70 Q71 R73 G74 D78 K79 R81 W82 P83 E84 K85 Q96 N100 H103 Y117 C118 V119 R121 R125 R127 T129 F130 R131 A132 H133 G134 R135 I136 S137 K138 Y139 E140 Q142	Y3 K14 S15 R16 S23 K25 N26 Y28 R41 K60 F61 Y62 K63 G64 G66 R67 H68 S69 Q70 R72 G73 D77 K78 R80 W81 P82 E83 K84 Q95 N99 H102 Y116 C117 V118 R120 R124 R126 T128 F129 R130 A131 H132 G133 R134 I135 S136 K137 Y138 E139 Q141

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8br8, PDBe:8br8, PDBj:8br8
PDBsum	8br8
PubMed	36912103
UniProt	A8BE76

[Back to BioLiP]