Structure of PDB 7cpv Chain LQ

Receptor sequence

>7cpvLQ (length=187) Species: 10090 (Mus musculus)

GVDIRHNKDRKVRRKEPKSQDIYLRLLVKLYRFLARRTNSTFNQVVLKRL
FMSRTNRPPLSLSRMIRKMKLPGRENKTAVVVGTVTDDVRILEVPKLKVC
ALRVSSRARSRILKAGGKILTFDQLALESPKGRGTVLLSGPRKGREVYRH
FGKAPGTPHSHTKPYVRSKGRKFERARGRRASRGYKN

3D structure

• PDB: 7cpv A male germ-cell-specific ribosome controls male fertility.
• Chain: LQ
• Resolution: 3.03 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LQ	G2 H7 N8 D10 R11 K12 V13 R14 R15 K16 S20 K30 F34 R37 R38 T42 M53 S54 R55 T56 S62 S64 R65 R68 K71 L72 P73 R75 K78 T85 T87 D88 D89 V90 R91 R104 S106 S107 R108 R134 G135 T136 L138 S140 P142 R143 K144 R146 E147 R150 F152 T158 P159 H160 H162 K164 P165 Y166 R168 S169 R172 K173 F174 E175 R181 S183 R184 G185 Y186 K187 N188	G1 H6 N7 D9 R10 K11 V12 R13 R14 K15 S19 K29 F33 R36 R37 T41 M52 S53 R54 T55 S61 S63 R64 R67 K70 L71 P72 R74 K77 T84 T86 D87 D88 V89 R90 R103 S105 S106 R107 R133 G134 T135 L137 S139 P141 R142 K143 R145 E146 R149 F151 T157 P158 H159 H161 K163 P164 Y165 R167 S168 R171 K172 F173 E174 R180 S182 R183 G184 Y185 K186 N187

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005730 nucleolus
• GO:0005737 cytoplasm
• GO:0005783 endoplasmic reticulum
• GO:0005791 rough endoplasmic reticulum
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:0022626 cytosolic ribosome
• GO:0043232 intracellular non-membrane-bounded organelle
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7cpv, PDBe:7cpv, PDBj:7cpv
• PDBsum: 7cpv
• PubMed: 36517592
• UniProt: P35980|RL18_MOUSE Large ribosomal subunit protein eL18 (Gene Name=Rpl18)