Structure of PDB 6t7t Chain LQ

Receptor sequence

>6t7tLQ (length=185) Species: 559292 (Saccharomyces cerevisiae S288C)

GIDHTSKQHKRSGHRTAPKSDNVYLKLLVKLYTFLARRTDAPFNKVVLKA
LFLSKINRPPVSVSRIARALKQEGAANKTVVVVGTVTDDARIFEFPKTTV
AALRFTAGARAKIVKAGGECITLDQLAVRAPKGQNTLILRGPRNSREAVR
HFGMGPHKGKAPRILSTGRKFERARGRRRSKGFKV

3D structure

• PDB: 6t7t Molecular mechanism of translational stalling by inhibitory codon combinations and poly(A) tracts.
• Chain: LQ
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LQ	G2 H5 T6 K8 H10 K11 R12 S13 G14 H15 R16 K20 S21 K31 F35 R38 R39 P43 L54 S55 K56 I57 S65 R66 R69 Q73 E74 K79 T86 T88 D89 D90 R92 I93 T107 I139 R141 G142 R144 N145 S146 R147 E148 R151 F153 A162 R164 S167 R170 K171 F172 E173 R178 R179 R180 S181 K182 F184 K185 V186	G1 H4 T5 K7 H9 K10 R11 S12 G13 H14 R15 K19 S20 K30 F34 R37 R38 P42 L53 S54 K55 I56 S64 R65 R68 Q72 E73 K78 T85 T87 D88 D89 R91 I92 T106 I138 R140 G141 R143 N144 S145 R146 E147 R150 F152 A161 R163 S166 R169 K170 F171 E172 R177 R178 R179 S180 K181 F183 K184 V185

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:0043232 intracellular non-membrane-bounded organelle
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6t7t, PDBe:6t7t, PDBj:6t7t
• PDBsum: 6t7t
• PubMed: 31858614
• UniProt: P0CX49|RL18A_YEAST Large ribosomal subunit protein eL18A (Gene Name=RPL18A)