Structure of PDB 7qca Chain LPP

Receptor sequence
>7qcaLPP (length=87) Species: 1358809 (Spraguea lophii 42_110) [Search protein sequence]
SRKTKKVGITGKYGSRYGSSLKRRAMICMNAQSKRYCCSFCGKTTVKREV
IGIWSCRFCGKKVSGGAYVPITNQQVEYKQVINRMKM
3D structure
PDB7qca Spraguea lophii ribosome
ChainLPP
Resolution2.79 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna LPP S2 R3 K4 T5 K6 V8 G9 G12 K13 S16 R17 Y18 G19 S20 S21 R36 K44 R49 V51 S1 R2 K3 T4 K5 V7 G8 G11 K12 S15 R16 Y17 G18 S19 S20 R35 K43 R48 V50
BS02 ZN LPP C39 C42 C57 C60 C38 C41 C56 C59
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sun Dec 1 04:54:46 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7qca', asym_id = 'LPP', title = 'Spraguea lophii ribosome'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7qca', asym_id='LPP', title='Spraguea lophii ribosome')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '7qca', asym_id = 'LPP'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='7qca', asym_id='LPP')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>