Structure of PDB 6rm3 Chain LP0

Receptor sequence
>6rm3LP0 (length=154) Species: 6039 (Vairimorpha necatrix) [Search protein sequence]
AINFAYDVVDPTKVIKSQIDSARVSFKKTRETANTLRKRSLLNAISYLNN
VVVKKECVPMRRYARGCGHTRQARAFNQRKGRWPKKSALALLQVLENIKE
QAVEKGLEVEKLDLDHVQICRAPKVFGRIFRAHGRVNPFNKSPCHILVAA
KVRD
3D structure
PDB6rm3 Evolutionary compaction and adaptation visualized by the structure of the dormant microsporidian ribosome.
ChainLP0
Resolution3.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna LP0 R63 Y64 R66 H70 R72 R80 K81 R83 W84 K87 R122 F131 R132 R136 N138 P139 F140 N141 K142 R62 Y63 R65 H69 R71 R79 K80 R82 W83 K86 R121 F130 R131 R135 N137 P138 F139 N140 K141
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sat Mar 1 02:40:15 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6rm3', asym_id = 'LP0', title = 'Evolutionary compaction and adaptation visualize...structure of the dormant microsporidian ribosome.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6rm3', asym_id='LP0', title='Evolutionary compaction and adaptation visualize...structure of the dormant microsporidian ribosome.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003735,0005840,0006412,0015934', uniprot = '', pdbid = '6rm3', asym_id = 'LP0'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412,0015934', uniprot='', pdbid='6rm3', asym_id='LP0')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>