Structure of PDB 8pv2 Chain LP

Receptor sequence

>8pv2LP (length=171) Species: 759272 (Thermochaetoides thermophila DSM 1495)

VRYAATEIAPTKSARARGSYLRVSFKNTRETAQAINGWKLQRALTFLQNV
IDKKEAVPMRRYAGSTGRTAQGKQWGVSRARWPVKSAQFLIGLLKNAEAN
ADAKGLDTGNLIIKHIQVNQAPKQRRRTYRAHGRINPYMSNPCHIELILT
EAEESHLSSRQRGVRIRRALT

3D structure

• PDB: 8pv2 Structural insights into coordinating 5S RNP rotation with ITS2 pre-RNA processing during ribosome formation.
• Chain: LP
• Resolution: 2.63 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LP	V2 R3 Y4 R16 R18 Y21 R23 S25 F26 K27 R30 Q34 K55 R62 Y63 G65 S66 T67 G68 R69 T70 A71 Q72 K74 Q75 R80 R82 W83 P84 V85 K86 N97 A100 N101 Q118 V119 Q121 R126 R127 Y130 R131 A132 H133 G134 N137 P138 Y139 M140 S141 H170 L171 S173 R174 R176 G177 V178 R179 R181 R182 T185	V1 R2 Y3 R15 R17 Y20 R22 S24 F25 K26 R29 Q33 K54 R61 Y62 G64 S65 T66 G67 R68 T69 A70 Q71 K73 Q74 R79 R81 W82 P83 V84 K85 N96 A99 N100 Q117 V118 Q120 R125 R126 Y129 R130 A131 H132 G133 N136 P137 Y138 M139 S140 H156 L157 S159 R160 R162 G163 V164 R165 R167 R168 T171
BS02	rna	LP	R3 A5 R61 R62 N120 Q121 P123 H145	R2 A4 R60 R61 N119 Q120 P122 H144

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8pv2, PDBe:8pv2, PDBj:8pv2
• PDBsum: 8pv2
• PubMed: 37921038
• UniProt: G0SGY1