Structure of PDB 8k2a Chain LP

Receptor sequence

>8k2aLP (length=221) Species: 9606 (Homo sapiens) [Search protein sequence]

KTLLPVPSFEDVSIPEKPKLRFIERAPLVPKVRREPKNLSDIRGPSTEAT
EFTEGNFAILALGGGYLHWGHFEMMRLTINRSMDPKNMFAIWRVPAPFKP
ITRKSVGHRMGGGKGAIDHYVTPVKAGRLVVEMGGRCEFEEVQGFLDQVA
HKLPFAAKAVSRGTLEKMRKDQEERERNNQNPWTFERIATANMLGIRKVL
SPYDLTHKGKYWGKFYMPKRV

3D structure

PDB

8k2a Structural basis for differential inhibition of eukaryotic ribosomes by tigecycline.

Chain

Resolution

2.9 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LP	K31 R63 R64 P66 K67 N68 L69 R73 Y96 H98 H101 M104 R133 K134 R139 M140 G141 G142 G143 K144 Q178 H181 K182 P184 R227 K228 V229 L230 S231 Y233 K244	K1 R33 R34 P36 K37 N38 L39 R43 Y66 H68 H71 M74 R103 K104 R109 M110 G111 G112 G113 K114 Q148 H151 K152 P154 R197 K198 V199 L200 S201 Y203 K214
BS02	MG	LP	H181 L183	H151 L153

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0032543	mitochondrial translation

	Cellular Component
GO:0005739	mitochondrion
GO:0005743	mitochondrial inner membrane
GO:0005762	mitochondrial large ribosomal subunit
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8k2a, PDBe:8k2a, PDBj:8k2a
PDBsum	8k2a
PubMed	38942792
UniProt	Q9NX20\|RM16_HUMAN Large ribosomal subunit protein uL16m (Gene Name=MRPL16)

[Back to BioLiP]