Structure of PDB 8i9y Chain LP

Receptor sequence

>8i9yLP (length=169) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence]

RYAATEIAPTKSARARGSYLRVSFKNTRETAQAINGWKLQRALTFLQNVI
DKKEAVPMRRYAGSTGRTAQGKQWGVSRARWPVKSAQFLIGLLKNAEANA
DAKGLDTGNLIIKHIQVNQAPKQRRRTYRAHGRINPYMSNPCHIELILTE
AESHLSSRQRGVRIRRALT

3D structure

PDB

8i9y Mechanism of 5S RNP recruitment and helicase-surveilled rRNA maturation during pre-60S biogenesis.

Chain

Resolution

3.1 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LP	R3 Y4 R16 R18 Y21 S25 N28 R30 Q34 R43 K54 R62 Y63 G65 S66 R69 A71 Q72 K74 Q75 R80 R82 W83 P84 K86 N97 A100 N101 H116 Q118 V119 R127 Y130 R135 N137 P138 Y139 M140 S141 N142 H170 S173 R174 R176 G177 V178 R179 R181 R182	R1 Y2 R14 R16 Y19 S23 N26 R28 Q32 R41 K52 R60 Y61 G63 S64 R67 A69 Q70 K72 Q73 R78 R80 W81 P82 K84 N95 A98 N99 H114 Q116 V117 R125 Y128 R133 N135 P136 Y137 M138 S139 N140 H154 S157 R158 R160 G161 V162 R163 R165 R166
BS02	rna	LP	R3 A5 R61 R62 N120 Q121 P123	R1 A3 R59 R60 N118 Q119 P121

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8i9y, PDBe:8i9y, PDBj:8i9y
PDBsum	8i9y
PubMed	37129998
UniProt	G0SGY1

[Back to BioLiP]