Structure of PDB 8i9r Chain LP

Receptor sequence

>8i9rLP (length=154) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence]

VRYAATEIAPTKSARARGSYLRVSFKNTRETAQAINGWKLQRALTFLQNV
IDKKEAVPMRRYAGSTGRTAQGKQWGVSRARWPVKSAQFLIGLLKNAEAN
ADAKGLDTGNLIIKHIQVNQAPKQRRPYMSNPCHIELILTEAEETVQKSE
AVVR

3D structure

PDB

8i9r Mechanism of 5S RNP recruitment and helicase-surveilled rRNA maturation during pre-60S biogenesis.

Chain

Resolution

3.1 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LP	V2 R3 R16 R18 S20 Y21 S25 F26 R30 K54 R62 Y63 A64 T67 R82 W83 K86 N101 H116 V119 R126 R127 Y139 M140 S141 N142 E154 V157 Q158 K159	V1 R2 R15 R17 S19 Y20 S24 F25 R29 K53 R61 Y62 A63 T66 R81 W82 K85 N100 H115 V118 R125 R126 Y128 M129 S130 N131 E143 V146 Q147 K148
BS02	rna	LP	R61 R62 N120 Q121 P123 H145	R60 R61 N119 Q120 P122 H134

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8i9r, PDBe:8i9r, PDBj:8i9r
PDBsum	8i9r
PubMed	37129998
UniProt	G0SGY1

[Back to BioLiP]