Structure of PDB 7z3n Chain LP

Receptor sequence

>7z3nLP (length=186) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence]

VRYAATEIAPTKSARARGSYLRVSFKNTRETAQAINGWKLQRALTFLQNV
IDKKEAVPMRRYAGSTGRTAQGKQWGVSRARWPVKSAQFLIGLLKNAEAN
ADAKGLDTGNLIIKHIQVNQAPKQRRRTYRAHGRINPYMSNPCHIELILT
EAEETVQKSEAVVRDVESHLSSRQRGVRIRRALTAA

3D structure

PDB

7z3n Structural inventory of cotranslational protein folding by the eukaryotic RAC complex.

Chain

Resolution

3.2 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	LP	R3 Y4 Y21 R23 K27 R30 R43 R62 Y63 G65 S66 R69 A71 Q72 K74 R80 R82 W83 N101 Q118 R127 Y130 R131 H133 G134 N137 P138 Y139 M140 S141 H170 R174 V178 R179 R181	R2 Y3 Y20 R22 K26 R29 R42 R61 Y62 G64 S65 R68 A70 Q71 K73 R79 R81 W82 N100 Q117 R126 Y129 R130 H132 G133 N136 P137 Y138 M139 S140 H169 R173 V177 R178 R180
BS02	rna	LP	A5 R61 N120 P123	A4 R60 N119 P122
BS03	MG	LP	Y130 R131	Y129 R130

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7z3n, PDBe:7z3n, PDBj:7z3n
PDBsum	7z3n
PubMed	37081320
UniProt	G0SGY1

[Back to BioLiP]