Structure of PDB 7olc Chain LP

Receptor sequence

>7olcLP (length=186) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence]

VRYAATEIAPTKSARARGSYLRVSFKNTRETAQAINGWKLQRALTFLQNV
IDKKEAVPMRRYAGSTGRTAQGKQWGVSRARWPVKSAQFLIGLLKNAEAN
ADAKGLDTGNLIIKHIQVNQAPKQRRRTYRAHGRINPYMSNPCHIELILT
EAEETVQKSEAVVRDVESHLSSRQRGVRIRRALTAA

3D structure

PDB

7olc High-resolution structures of a thermophilic eukaryotic 80S ribosome reveal atomistic details of translocation.

Chain

Resolution

2.9 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LP	R3 Y4 R16 A17 R18 Y21 R23 S25 K27 Q34 R43 R62 Y63 G65 S66 R69 A71 K74 R82 W83 K86 N97 N101 Q118 V119 R127 Y130 R131 H133 G134 R135 N137 P138 Y139 M140 S141 H170 S173 R174 V178	R2 Y3 R15 A16 R17 Y20 R22 S24 K26 Q33 R42 R61 Y62 G64 S65 R68 A70 K73 R81 W82 K85 N96 N100 Q117 V118 R126 Y129 R130 H132 G133 R134 N136 P137 Y138 M139 S140 H169 S172 R173 V177
BS02	rna	LP	R3 R61 R62	R2 R60 R61

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7olc, PDBe:7olc, PDBj:7olc
PDBsum	7olc
PubMed	35079002
UniProt	G0SGY1

[Back to BioLiP]