Structure of PDB 6t4q Chain LP

Receptor sequence

>6t4qLP (length=183) Species: 4932 (Saccharomyces cerevisiae)

ARYGATSTNPAKSASARGSYLRVSFKNTRETAQAINGWELTKAQKYLEQV
LDHQRAIPFRRFNSSIGRTAQGKEFGVTKARWPAKSVKFVQGLLQNAAAN
AEAKGLDATKLYVSHIQVNQAPKQRRRTYRAHGRINKYESSPSHIELVVT
EKEEAVAKAAEKKVVRLTSRQRGRIAAQKRIAA

3D structure

• PDB: 6t4q Molecular mechanism of translational stalling by inhibitory codon combinations and poly(A) tracts.
• Chain: LP
• Resolution: 2.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LP	R3 Y4 G5 A6 R61 R62 N120 Q121 P123	R2 Y3 G4 A5 R60 R61 N119 Q120 P122
BS02	rna	LP	R3 Y4 S16 R18 Y21 R23 S25 F26 K27 R30 Q34 K43 Q55 R56 R62 F63 S65 S66 I67 G68 R69 A71 Q72 K74 E75 K80 R82 W83 P84 K86 N97 A100 N101 H116 Q118 V119 Q121 K124 R127 Y130 R131 A132 H133 G134 R135 I136 N137 K138 Y139 E140 S141 R167 T169 S170 R171 Q172 G174 R175 R181	R2 Y3 S15 R17 Y20 R22 S24 F25 K26 R29 Q33 K42 Q54 R55 R61 F62 S64 S65 I66 G67 R68 A70 Q71 K73 E74 K79 R81 W82 P83 K85 N96 A99 N100 H115 Q117 V118 Q120 K123 R126 Y129 R130 A131 H132 G133 R134 I135 N136 K137 Y138 E139 S140 R166 T168 S169 R170 Q171 G173 R174 R180

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000448 cleavage in ITS2 between 5.8S rRNA and LSU-rRNA of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:0030687 preribosome, large subunit precursor
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6t4q, PDBe:6t4q, PDBj:6t4q
• PDBsum: 6t4q
• PubMed: 31858614
• UniProt: P05740|RL17A_YEAST Large ribosomal subunit protein uL22A (Gene Name=RPL17A)