Structure of PDB 7qca Chain LOO

Receptor sequence

>7qcaLOO (length=100) Species: 1358809 (Spraguea lophii 42_110) [Search protein sequence]

VNIPKTRRTYCIKCAYHTEFKVGLLKKGKDSPRKQGARRYARKQRGVHGQ
TKPILKRKAKTTKKVILKIECTKCKSSQLKVRGRAKHVEFGAEKKVKGEA

3D structure

PDB

7qca Spraguea lophii ribosome

Chain

LOO

Resolution

2.79 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LOO	V2 N3 P5 R8 R9 K14 Y17 H18 D31 R34 K35 Q36 G37 R39 R40 R43 K44 R46 V48 Q51 K53 P54 I55 K59 A60 K61 T63 K64 K65 S78 K81 R83 K87 K95 K96 K98	V1 N2 P4 R7 R8 K13 Y16 H17 D30 R33 K34 Q35 G36 R38 R39 R42 K43 R45 V47 Q50 K52 P53 I54 K58 A59 K60 T62 K63 K64 S77 K80 R82 K86 K94 K95 K97
BS02	ZN	LOO	C12 C15 C72 C75	C11 C14 C71 C74

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links