Structure of PDB 8rxh Chain LO

Receptor sequence

>8rxhLO (length=298) Species: 347515 (Leishmania major strain Friedlin) [Search protein sequence]

FVKVVKNKAYFKRFQVKYRRRREGKTDYHARRQMVLQDKTKFGSPKYRLV
VRITNKDIIAQIVQAKIVGDEVVMAAYAHELPAFGIEHGLTNYAAAYATG
LLLARRTLAKLGIADKFQGAKEADGSYSAVRTKKDDEGDDEERFPFKAIL
DVGLARTTTGARVFGVLKGAVDGGMAVPHRPNRFPGYNKEKSSLDAKVHR
DRIFGKHVADYLKQVKEEASSNPDEKCVQFSKYMAAKVLPESIEGMYKKA
HAAIRADPSKSLPKKAKVAHKSYKTKKLSGAEKRAAAKAKVAAIRERL

3D structure

PDB

8rxh Structural and mechanistic insights into the function of Leishmania ribosome lacking a single pseudouridine modification.

Chain

Resolution

2.93 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	LO	F3 K5 V6 R15 K43 F44 S46 I115 K135 R145 F146 P147 F148	F1 K3 V4 R13 K41 F42 S44 I113 K133 R143 F144 P145 F146
BS02	rna	LO	V4 K8 Y12 F16 Q17 K19 R23 T28 D29 H31 Q35 M36 K48 K136 I151 V154 L156 R158 T159 H181 R182 R185	V2 K6 Y10 F14 Q15 K17 R21 T26 D27 H29 Q33 M34 K46 K134 I149 V152 L154 R156 T157 H179 R180 R183
BS03	rna	LO	K8 K10 F13 K14 F16 V18 Y20 R21 R22 R24 T28 Y30 R33 R50 V52 R54 T56 N57 K58 I61 Q63 I69 V70 D72 E73 V74 N94 Y95 R158 T160 T161 A163 R164 R204 H209 V210 Y213 Q216 V230 Q231 F232 S233 K234 Y235 K269 V273 H275 Y278 K282 L283 G285 K288 R289 K293 V296	K6 K8 F11 K12 F14 V16 Y18 R19 R20 R22 T26 Y28 R31 R48 V50 R52 T54 N55 K56 I59 Q61 I67 V68 D70 E71 V72 N92 Y93 R156 T158 T159 A161 R162 R202 H207 V208 Y211 Q214 V228 Q229 F230 S231 K232 Y233 K267 V268 H270 Y273 K277 L278 G280 K283 R284 K288 V291

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0008097	5S rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8rxh, PDBe:8rxh, PDBj:8rxh
PDBsum	8rxh
PubMed	38722744
UniProt	E9AF09

[Back to BioLiP]