Structure of PDB 8pfr Chain LO

Receptor sequence

>8pfrLO (length=160) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

QNPMRDLKIEKLVLNISVGESGDRLTRASKVLEQLSGQTPVQSKARYTVR
TFGIRRNEKIAVHVTVRGPKAEEILERGLKVKEYQLRDRNFSATGNFGFG
IDEHIDLGFGMDFYVVMNRPGARVTRRKRCKGTVGNSHKTTKEDTVSWFK
QKYDADVLDK

3D structure

PDB

8pfr Real-space refinement in PHENIX for cryo-EM and crystallography.

Chain

Resolution

2.15 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LO	V18 N20 S22 S48 R51 Y52 F57 I59 A66 R94 N95 S97 A98 T99 G103 F104 G105 I106 D107 G124 D126 Y128 K142	V13 N15 S17 S43 R46 Y47 F52 I54 A61 R89 N90 S92 A93 T94 G98 F99 G100 I101 D102 G110 D112 Y114 K128
BS02	rna	LO	M9 Q43 T44 V46 V69 T70 R72 G135 R137 R141 G149 N150 H152	M4 Q38 T39 V41 V64 T65 R67 G121 R123 R127 G135 N136 H138

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8pfr, PDBe:8pfr, PDBj:8pfr
PDBsum	8pfr
PubMed
UniProt	P0C0W9\|RL11A_YEAST Large ribosomal subunit protein uL5A (Gene Name=RPL11A)

[Back to BioLiP]